WP_009889149.1 has 232 amino acids
Query: Phage_Mu_Gp48 [M=150] Accession: PF10076.13 Description: Bacteriophage Mu-like, Gp48 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-27 80.7 0.1 6.9e-27 80.3 0.1 1.1 1 WP_009889149.1 Domain annotation for each sequence (and alignments): >> WP_009889149.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.3 0.1 6.9e-27 6.9e-27 14 144 .. 13 141 .. 2 145 .. 0.90 Alignments for each domain: == domain 1 score: 80.3 bits; conditional E-value: 6.9e-27 Phage_Mu_Gp48 14 srelqalleaeakeldrveasaddllkeqfpetatwlLpdWEkilglpddssetleeRRaavlaklsekgglsiayleklaasllGeeeieIten 108 ++++++ a+++el+ +++++dd +++f++tatw+L+ WE+il + +++ +++ RR+ ++ak++++g+ +i+ ++++ +++++ e +I+ + WP_009889149.1 13 NYIVEEIQGAYDTELNILKEDIDDTFNQLFVDTATWGLDMWEDILCIEKKEL-DFDTRRSNIKAKMRSRGTSTIEVIKSICEAYTKS-ETDIKVY 105 457889999*************************************987655.8******************************996.******* PP Phage_Mu_Gp48 109 kerYilqVkvpgasgagenlealecelerikPahtd 144 +++++ +++ ++ + + l + +++er+kPah WP_009889149.1 106 SDEFTFVLSFIANNCDYKTLLDCSEMIERVKPAHLL 141 ***********9999999999*************43 PP
Or compare WP_009889149.1 to CDD or PaperBLAST