SwissProt::Q5U2S1 has 221 amino acids
Query: NEDD4_Bsd2 [M=130] Accession: PF10176.14 Description: NEDD4/Bsd2 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-32 97.2 15.4 1.8e-24 72.7 8.7 2.2 2 SwissProt::Q5U2S1 Domain annotation for each sequence (and alignments): >> SwissProt::Q5U2S1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.7 8.7 1.8e-24 1.8e-24 2 56 .. 111 165 .. 110 172 .. 0.95 2 ! 28.8 0.7 6.5e-11 6.5e-11 94 127 .. 176 209 .. 166 212 .. 0.90 Alignments for each domain: == domain 1 score: 72.7 bits; conditional E-value: 1.8e-24 NEDD4_Bsd2 2 pvGnifsflwnllvsfsFqlvGFlltyllhtthAakqGsraGlGltlvkyglivk 56 ++Gn+ +f+++++++f+F+++GF+l+++l+t++A+++G+++G+Gl+l+k++liv+ SwissProt::Q5U2S1 111 RIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVR 165 79****************************************************9 PP == domain 2 score: 28.8 bits; conditional E-value: 6.5e-11 NEDD4_Bsd2 94 ssewlayllmilGlfilirsivdYlkvkreeqlv 127 + wl++++++lG+++++r++++Y+kv+++ +++ SwissProt::Q5U2S1 176 GQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETF 209 589**************************98876 PP
Or compare SwissProt::Q5U2S1 to CDD or PaperBLAST