NP_651552.1 has 135 amino acids
Query: DUF2205 [M=75]
Accession: PF10224.13
Description: Short coiled-coil protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.3e-33 98.5 3.5 1.3e-32 98.0 3.5 1.2 1 NP_651552.1
Domain annotation for each sequence (and alignments):
>> NP_651552.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 98.0 3.5 1.3e-32 1.3e-32 6 74 .. 60 128 .. 56 129 .. 0.96
Alignments for each domain:
== domain 1 score: 98.0 bits; conditional E-value: 1.3e-32
DUF2205 6 nsedleklekeareeLqeqakeLqssLqalaervdaVkeehdKLesenkfLqkYIgdLmstskitssts 74
+++++ + ++e++++L++q+ eLq++L++l++rvd+Vkee++KL+sen++L++YI++Lms+s++++sts
NP_651552.1 60 EAMEMAQDDREEKARLITQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIENLMSASSVFQSTS 128
6789***************************************************************98 PP
Or compare NP_651552.1 to CDD or PaperBLAST