Q9UIL1 has 159 amino acids
Query: DUF2205 [M=75]
Accession: PF10224.13
Description: Short coiled-coil protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.4e-31 92.4 3.3 1e-30 92.0 3.3 1.2 1 Q9UIL1
Domain annotation for each sequence (and alignments):
>> Q9UIL1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 92.0 3.3 1e-30 1e-30 10 74 .. 89 153 .. 79 154 .. 0.92
Alignments for each domain:
== domain 1 score: 92.0 bits; conditional E-value: 1e-30
DUF2205 10 leklekeareeLqeqakeLqssLqalaervdaVkeehdKLesenkfLqkYIgdLmstskitssts 74
+++e e++++L++q+ eLq++L++l++rvdaVkee++KL+sen++L++YI++Lms+s+++++t+
Q9UIL1 89 ENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTD 153
578999*********************************************************97 PP
Or compare Q9UIL1 to CDD or PaperBLAST