NP_001229298.1 has 233 amino acids
Query: Cg6151-P [M=113]
Accession: PF10233.13
Description: Uncharacterized conserved protein CG6151-P
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.6e-34 103.4 6.8 5.8e-34 103.1 6.8 1.1 1 NP_001229298.1
Domain annotation for each sequence (and alignments):
>> NP_001229298.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 103.1 6.8 5.8e-34 5.8e-34 2 113 .] 35 143 .. 34 143 .. 0.97
Alignments for each domain:
== domain 1 score: 103.1 bits; conditional E-value: 5.8e-34
Cg6151-P 2 GilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatslivaav 96
G+l+++ c + G++n +t+++++i++++++++++f++l++E+P+++++++++++++e ++++ + w++a++Y++mavv+ +++ +++++++++
NP_001229298.1 35 GVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRL-RSWQKAVFYCGMAVVP-IVIS-LTLTTLLGNA 126
99*************88*********************************************.****************.6666.89******** PP
Cg6151-P 97 lllitavlYglaalkkq 113
++++t+vlYgl al+k+
NP_001229298.1 127 IAFATGVLYGLSALGKK 143
**************997 PP
Or compare NP_001229298.1 to CDD or PaperBLAST