TCDB::Q9UGQ2 has 172 amino acids
Query: Cg6151-P [M=113] Accession: PF10233.13 Description: Uncharacterized conserved protein CG6151-P Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-34 104.5 6.8 2.5e-34 104.2 6.8 1.1 1 TCDB::Q9UGQ2 Domain annotation for each sequence (and alignments): >> TCDB::Q9UGQ2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.2 6.8 2.5e-34 2.5e-34 2 113 .] 35 143 .. 34 143 .. 0.97 Alignments for each domain: == domain 1 score: 104.2 bits; conditional E-value: 2.5e-34 Cg6151-P 2 GilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatslivaavll 98 G+l+++ c + G++n +t+++++i++++++++++f++l++E+P+++++++++++++e ++++ + w++a++Y++mavv+ +++ +++++++++++ TCDB::Q9UGQ2 35 GVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRL-RSWQKAVFYCGMAVVP-IVIS-LTLTTLLGNAIA 128 99*************88*********************************************.****************.6666.89********** PP Cg6151-P 99 litavlYglaalkkq 113 ++t+vlYgl al+k+ TCDB::Q9UGQ2 129 FATGVLYGLSALGKK 143 ************997 PP
Or compare TCDB::Q9UGQ2 to CDD or PaperBLAST