VIMSS6582745 has 218 amino acids
Query: KxDL [M=86]
Accession: PF10241.13
Description: Uncharacterized conserved protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-27 81.2 3.1 4.7e-27 80.5 3.1 1.4 1 VIMSS6582745
Domain annotation for each sequence (and alignments):
>> VIMSS6582745
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.5 3.1 4.7e-27 4.7e-27 1 86 [] 115 200 .. 115 200 .. 0.99
Alignments for each domain:
== domain 1 score: 80.5 bits; conditional E-value: 4.7e-27
KxDL 1 rlssavdsedldeilalQaqtsgrlnkknreLlelnalsqerlaklrarfkqgtkllkevkkdLesifkkirslkaklakkyPeeY 86
+l++++ds+d++e+l+lQ++ts+++n+k+ eL++ ++++++rl++l+++f++g ++k++k+dLe ++k+i+ l+a l+ ++P+e+
VIMSS6582745 115 SLKQSIDSADFSEALSLQTKTSAVINSKSLELKQYIDEMKSRLTQLQEKFENGEATSKKIKRDLETSRKNIDYLNAALRVDFPIEF 200
699**********************************************************************************9 PP
Or compare VIMSS6582745 to CDD or PaperBLAST