CharProtDB::CH_122814 has 468 amino acids
Query: YJL171C_Tos1_N [M=63] Accession: PF10290.13 Description: Cell wall protein YJL171C/Tos1, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-32 97.5 0.9 6.7e-32 96.1 0.1 2.2 2 CharProtDB::CH_122814 Domain annotation for each sequence (and alignments): >> CharProtDB::CH_122814 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.1 0.1 6.7e-32 6.7e-32 2 63 .] 37 98 .. 36 98 .. 0.98 2 ? -2.4 0.1 0.38 0.38 9 37 .. 382 410 .. 379 425 .. 0.66 Alignments for each domain: == domain 1 score: 96.1 bits; conditional E-value: 6.7e-32 YJL171C_Tos1_N 2 aieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63 ++ y+++gfsGsY++vt+mde++g+C+++ +sfsG+l+PldeelSvhfRGPl+L qf+vY+p CharProtDB::CH_122814 37 KVIYKGIGFSGSYMDVTNMDENTGKCTQQLYSFSGNLSPLDEELSVHFRGPLTLLQFGVYYP 98 799*********************************************************96 PP == domain 2 score: -2.4 bits; conditional E-value: 0.38 YJL171C_Tos1_N 9 gfsGsYkevtsmdessgsCeveeksfsGp 37 sGs k ++++++ +gs + +++ G+ CharProtDB::CH_122814 382 LSSGSNKMISHLHDGQGSSQNSNNGGGGS 410 57888899999998877766666555554 PP
Or compare CharProtDB::CH_122814 to CDD or PaperBLAST