P38288 has 455 amino acids
Query: YJL171C_Tos1_N [M=63] Accession: PF10290.13 Description: Cell wall protein YJL171C/Tos1, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-32 96.6 0.0 1.3e-31 95.1 0.0 1.9 1 P38288 Domain annotation for each sequence (and alignments): >> P38288 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.1 0.0 1.3e-31 1.3e-31 1 63 [] 38 100 .. 38 100 .. 0.98 Alignments for each domain: == domain 1 score: 95.1 bits; conditional E-value: 1.3e-31 YJL171C_Tos1_N 1 daieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63 dai ysnvg s++Y++vt+mdess++C++++ + sG+laP++eelSvhfRGP++L qf+vY+p P38288 38 DAIIYSNVGLSATYQDVTNMDESSCACTQADFTASGSLAPFNEELSVHFRGPIELLQFGVYYP 100 689**********************************************************96 PP
Or compare P38288 to CDD or PaperBLAST