SwissProt::A0A1D8PJA8 has 467 amino acids
Query: YJL171C_Tos1_N [M=63] Accession: PF10290.13 Description: Cell wall protein YJL171C/Tos1, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-33 99.3 1.1 1.6e-32 98.0 0.1 2.2 2 SwissProt::A0A1D8PJA8 Domain annotation for each sequence (and alignments): >> SwissProt::A0A1D8PJA8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.0 0.1 1.6e-32 1.6e-32 2 63 .] 37 98 .. 36 98 .. 0.98 2 ? -2.4 0.1 0.37 0.37 9 37 .. 381 409 .. 378 424 .. 0.66 Alignments for each domain: == domain 1 score: 98.0 bits; conditional E-value: 1.6e-32 YJL171C_Tos1_N 2 aieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63 ++ y+++gfsG+Y++vt+mdes+g+C+++++sfsG+l+PldeelSvhfRGPl+L qf+vY+p SwissProt::A0A1D8PJA8 37 KVIYKGIGFSGTYMDVTNMDESTGKCTQQSYSFSGNLSPLDEELSVHFRGPLTLLQFGVYYP 98 799*********************************************************96 PP == domain 2 score: -2.4 bits; conditional E-value: 0.37 YJL171C_Tos1_N 9 gfsGsYkevtsmdessgsCeveeksfsGp 37 sGs k ++++++ +gs + +++ G+ SwissProt::A0A1D8PJA8 381 LSSGSNKMISHLHDGQGSSQNSNNGGGGS 409 57888899999998877766666555554 PP
Or compare SwissProt::A0A1D8PJA8 to CDD or PaperBLAST