VIMSS6579320 has 507 amino acids
Query: YJL171C_Tos1_N [M=63]
Accession: PF10290.13
Description: Cell wall protein YJL171C/Tos1, N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.9e-32 96.5 0.4 1.3e-31 95.1 0.4 1.8 1 VIMSS6579320
Domain annotation for each sequence (and alignments):
>> VIMSS6579320
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 95.1 0.4 1.3e-31 1.3e-31 2 63 .] 39 100 .. 38 100 .. 0.98
Alignments for each domain:
== domain 1 score: 95.1 bits; conditional E-value: 1.3e-31
YJL171C_Tos1_N 2 aieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63
++e++nvg+s++Y+e+t+md+ss+sC++++ks+ G+laP+dee S+hfRGP++Lk+favY+p
VIMSS6579320 39 EVEFTNVGYSSTYNEITNMDTSSCSCSSTPKSYGGNLAPFDEEFSFHFRGPIELKRFAVYYP 100
79**********************************************************96 PP
Or compare VIMSS6579320 to CDD or PaperBLAST