PaperBLAST – Find papers about a protein or its homologs

 

Align XP_003015267.1 to PF10290 (YJL171C_Tos1_N)

XP_003015267.1 has 440 amino acids

Query:       YJL171C_Tos1_N  [M=63]
Accession:   PF10290.13
Description: Cell wall protein YJL171C/Tos1, N-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      2e-24   72.1   0.4    4.8e-24   70.9   0.1    1.8  2  XP_003015267.1  


Domain annotation for each sequence (and alignments):
>> XP_003015267.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   70.9   0.1   4.8e-24   4.8e-24       2      62 ..      38      96 ..      37      97 .. 0.97
   2 ?   -3.7   0.0      0.93      0.93      12      31 ..     349     368 ..     347     377 .. 0.63

  Alignments for each domain:
  == domain 1  score: 70.9 bits;  conditional E-value: 4.8e-24
  YJL171C_Tos1_N  2 aieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYt 62
                     i+ys++++sG+Y+ vtsm+   g+C +e++++sG+++Pl eelS+h+RGP++L ++avY+
  XP_003015267.1 38 LITYSGFSTSGTYDLVTSMS--GGKCGSEKHEYSGAFGPLGEELSIHLRGPMQLFSMAVYN 96
                    59******************..79************************************8 PP

  == domain 2  score: -3.7 bits;  conditional E-value: 0.93
  YJL171C_Tos1_N  12 GsYkevtsmdessgsCevee 31 
                     G+++  + + + + +C+++ 
  XP_003015267.1 349 GEFDVLEVLAPGDKRCKSTY 368
                     56666667777778888763 PP



Or compare XP_003015267.1 to CDD or PaperBLAST