XP_003015267.1 has 440 amino acids
Query: YJL171C_Tos1_N [M=63] Accession: PF10290.13 Description: Cell wall protein YJL171C/Tos1, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-24 72.1 0.4 4.8e-24 70.9 0.1 1.8 2 XP_003015267.1 Domain annotation for each sequence (and alignments): >> XP_003015267.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.9 0.1 4.8e-24 4.8e-24 2 62 .. 38 96 .. 37 97 .. 0.97 2 ? -3.7 0.0 0.93 0.93 12 31 .. 349 368 .. 347 377 .. 0.63 Alignments for each domain: == domain 1 score: 70.9 bits; conditional E-value: 4.8e-24 YJL171C_Tos1_N 2 aieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYt 62 i+ys++++sG+Y+ vtsm+ g+C +e++++sG+++Pl eelS+h+RGP++L ++avY+ XP_003015267.1 38 LITYSGFSTSGTYDLVTSMS--GGKCGSEKHEYSGAFGPLGEELSIHLRGPMQLFSMAVYN 96 59******************..79************************************8 PP == domain 2 score: -3.7 bits; conditional E-value: 0.93 YJL171C_Tos1_N 12 GsYkevtsmdessgsCevee 31 G+++ + + + + +C+++ XP_003015267.1 349 GEFDVLEVLAPGDKRCKSTY 368 56666667777778888763 PP
Or compare XP_003015267.1 to CDD or PaperBLAST