VIMSS6579692 has 124 amino acids
Query: DUF2406 [M=64]
Accession: PF10295.13
Description: Uncharacterised protein (DUF2406)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-21 62.4 0.0 5e-21 61.5 0.0 1.5 1 VIMSS6579692
Domain annotation for each sequence (and alignments):
>> VIMSS6579692
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.5 0.0 5e-21 5e-21 1 63 [. 12 71 .. 12 72 .. 0.90
Alignments for each domain:
== domain 1 score: 61.5 bits; conditional E-value: 5e-21
DUF2406 1 AvqEaqPfeqaadkslaslrsiqrqsykDvfGnpiadpDlSNPtRsrdERPLDTIRsFeyait 63
A++E +P e a++++ +++s kD +G++i++pD NPtR r ERPLDT+R+++y i+
VIMSS6579692 12 AITELEPYEMAQTNKEVPTTSLLS---KDYYGHSIEEPDENNPTRWRYERPLDTVRAWQYLID 71
899*******99955666666666...*********************************997 PP
Or compare VIMSS6579692 to CDD or PaperBLAST