PaperBLAST – Find papers about a protein or its homologs

 

Align B3KX42 to PF10300 (DUF3808)

B3KX42 has 795 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.9e-10   26.1   0.3    1.9e-10   26.1   0.3    2.3  3  B3KX42    


Domain annotation for each sequence (and alignments):
>> B3KX42  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.1   0.3   1.9e-10   1.9e-10     260     371 ..     233     342 ..     204     351 .. 0.87
   2 ?   -2.6   0.1     0.092     0.092     276     331 ..     431     482 ..     423     491 .. 0.54
   3 ?   -2.0   0.0     0.064     0.064     284     325 ..     508     544 ..     493     594 .. 0.49

  Alignments for each domain:
  == domain 1  score: 26.1 bits;  conditional E-value: 1.9e-10
  DUF3808 260 ksrkrfPksalwllfearieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaacllelgreek 361
                +k f++  ++ ++ + i+  + n  +A++ + +++++  s  kq++  ++ ++++t++   +y++a++s ++++++    ka Y+    +c+ ++g+ ek
   B3KX42 233 VKNKMFSNAGILKMNMGNIYLKQRNYSKAIKFYRMALDQVPSVNKQMRIKIMQNIGVTFIQAGQYSDAINSYEHIMSMAPNLKAGYN--LTICYFAIGDREK 332
              45688*******************************************************************************987..5688888988888 PP

  DUF3808 362 kaeakekaee 371
              +++a +k+ +
   B3KX42 333 MKKAFQKLIT 342
              8777666655 PP

  == domain 2  score: -2.6 bits;  conditional E-value: 0.092
  DUF3808 276 arieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesf 331
              a  +  +++ ++A+e l+ + e++      vk+    +l+  + + +++ +a  ++
   B3KX42 431 AVTYLRQKDYNQAVEFLKVL-EKK---DNRVKSAAATNLSALYYMGKDFAQASSYA 482
              44444556666666666633.222...23345555555555555555555555555 PP

  == domain 3  score: -2.0 bits;  conditional E-value: 0.064
  DUF3808 284 nldeAlelleeiieesqselkqvkhlclfelaltlvylheyk 325
              + ++A e ++e++  ++s+  +     l++++lt+  l + +
   B3KX42 508 DYEKAAEFYKEAL-RNDSSCTE----ALYNIGLTYEKLNRLD 544
              4444444444443.22222222....2333333333333333 PP



Or compare B3KX42 to CDD or PaperBLAST