PaperBLAST – Find papers about a protein or its homologs

 

Align NP_783195.2 to PF10300 (DUF3808)

NP_783195.2 has 833 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-10   26.2   0.4    1.8e-10   26.2   0.4    2.4  2  NP_783195.2  


Domain annotation for each sequence (and alignments):
>> NP_783195.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.2   0.4   1.8e-10   1.8e-10     260     371 ..     233     342 ..     204     392 .. 0.88
   2 ?   -1.9   0.1     0.058     0.058     276     333 ..     431     484 ..     426     522 .. 0.69

  Alignments for each domain:
  == domain 1  score: 26.2 bits;  conditional E-value: 1.8e-10
      DUF3808 260 ksrkrfPksalwllfearieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaacllelg 357
                    +k f++  ++ ++ + i+  + n  +A++ + +++++  s  kq++  ++ ++++t++   +y++a++s ++++++    ka Y+    +c+ ++g
  NP_783195.2 233 VKNKMFSNAGILKMNMGNIYLKQRNYSKAIKFYRMALDQVPSVNKQMRIKIMQNIGVTFIQAGQYSDAINSYEHIMSMAPNLKAGYN--LTICYFAIG 328
                  45688*******************************************************************************987..568888888 PP

      DUF3808 358 reekkaeakekaee 371
                  + ek+++a +k+ +
  NP_783195.2 329 DREKMKKAFQKLIT 342
                  88887777666655 PP

  == domain 2  score: -1.9 bits;  conditional E-value: 0.058
      DUF3808 276 arieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfle 333
                  a  +  +++ ++A+e+l+ + e+++s    vk+    +l+  + + +++ +a  +++ 
  NP_783195.2 431 AVTYLRQKDYNQAVEILKVL-EKKDS---RVKSAAATNLSALYYMGKDFAQASSYADI 484
                  44555667777777777743.23333...35566666666666666777777666665 PP



Or compare NP_783195.2 to CDD or PaperBLAST