PaperBLAST – Find papers about a protein or its homologs

 

Align Q13099 to PF10300 (DUF3808)

Q13099 has 824 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.8e-10   26.2   0.4    1.8e-10   26.2   0.4    2.4  3  Q13099    


Domain annotation for each sequence (and alignments):
>> Q13099  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.2   0.4   1.8e-10   1.8e-10     260     371 ..     224     333 ..     195     383 .. 0.88
   2 ?   -2.0   0.1     0.061     0.061     276     333 ..     422     475 ..     417     509 .. 0.69
   3 ?   -2.6   0.0     0.091     0.091     279     345 ..     494     522 ..     484     573 .. 0.54

  Alignments for each domain:
  == domain 1  score: 26.2 bits;  conditional E-value: 1.8e-10
  DUF3808 260 ksrkrfPksalwllfearieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaacllelgreek 361
                +k f++  ++ ++ + i+  + n  +A++ + +++++  s  kq++  ++ ++++t++   +y++a++s ++++++    ka Y+    +c+ ++g+ ek
   Q13099 224 VKNKMFSNAGILKMNMGNIYLKQRNYSKAIKFYRMALDQVPSVNKQMRIKIMQNIGVTFIQAGQYSDAINSYEHIMSMAPNLKAGYN--LTICYFAIGDREK 323
              45688*******************************************************************************987..5688888888888 PP

  DUF3808 362 kaeakekaee 371
              +++a +k+ +
   Q13099 324 MKKAFQKLIT 333
              7777666655 PP

  == domain 2  score: -2.0 bits;  conditional E-value: 0.061
  DUF3808 276 arieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfle 333
              a  +  +++ ++A+e+l+ + e+++s    vk+    +l+  + + +++ +a  +++ 
   Q13099 422 AVTYLRQKDYNQAVEILKVL-EKKDS---RVKSAAATNLSALYYMGKDFAQASSYADI 475
              44555667777777777743.23333...35566666666666667777777666665 PP

  == domain 3  score: -2.6 bits;  conditional E-value: 0.091
  DUF3808 279 eslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalY 345
               +++g+ ++A e ++e++  ++                                     s+   alY
   Q13099 494 VFANGDYEKAAEFYKEAL-RND-------------------------------------SSCTEALY 522
              444455555555555544.333.....................................33333333 PP



Or compare Q13099 to CDD or PaperBLAST