PaperBLAST – Find papers about a protein or its homologs

 

Align XP_022187702.1 to PF10300 (DUF3808)

XP_022187702.1 has 589 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   2.2e-135  438.1   4.8   2.2e-135  438.1   4.8    1.5  2  XP_022187702.1  


Domain annotation for each sequence (and alignments):
>> XP_022187702.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  438.1   4.8  2.2e-135  2.2e-135       2     476 ..      35     487 ..      34     488 .. 0.94
   2 ?   -2.9   0.0      0.11      0.11     280     295 ..     527     542 ..     517     569 .. 0.59

  Alignments for each domain:
  == domain 1  score: 438.1 bits;  conditional E-value: 2.2e-135
         DUF3808   2 qaldlvLndkfeeaeellkeaskeSslhalgrgviafleAvltfepekmkkAsealkeaeklceksrkkaqkne......skqnlssdslyepgl 90 
                      a+ l++n+kf+ea + lk++ ++S++h +g++v+ f+eAvltf+p  ++k+sealk++ +lc+ +rkk + ++      +k+n+  d+++++++
  XP_022187702.1  35 IAVHLFFNNKFDEAWDMLKPWVGSSMYHTIGNSVFCFMEAVLTFDPTSIQKTSEALKQSIALCNFYRKKRNAINsigkyvKKTNY--DHYTTEEV 127
                     5899******************************************************************99999**99888877..89****** PP

         DUF3808  91 eaevcyaealLlkAlLtf.lseslvefiKgglklRkaYqiykeilkeikklekkkrskteeeeesllseeknsqaeideflesGvnlgfGilqlv 184
                     +ae+cyaealLlk+lLtf  +e+lv+fi +glk+R++++ yke++  ++              ++++   ++   +++ ++esGv++g+G+++l+
  XP_022187702.1 128 HAELCYAEALLLKSLLTFiEDETLVSFIRAGLKIRSCFNSYKECQIILN--------------TKHWV--ND---NYKLHFESGVRMGIGAFNLM 203
                     ******************99***************************99..............22334..33...79****************** PP

         DUF3808 185 iSllPpailklLsvvGFsGdreeGLrlLweask.srnlraalallaLlfYytgvvqvldiddglkapleeleelLlksrkrfPksalwllfeari 278
                     iSllP++i+klL+++GFsG+++ GL +L    +  + lr +l++++Ll+Y+ +vv+vl+     +++le ++e+L+++ k+fP++a++l+f++r+
  XP_022187702.1 204 ISLLPSRIIKLLEFIGFSGSKDIGLDELVACYEsPHGLRHILSVMTLLTYNLIVVYVLSR---SEGDLEFCDEILKEQMKLFPDGAWFLFFKGRL 295
                     ******************************8775899***********************...689***************************** PP

         DUF3808 279 eslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaacllelgreekkaeakekaeelf 373
                     e++kgnl e+ +++ +++ +sq+ + q++hlc+++l++t+++++e++ea+ ++++L+ +skwS+++Y Y++++ +l+++ + + a + +++ +++
  XP_022187702.1 296 EFMKGNLVESNNWYVKSW-KSQQVWPQFHHLCFWDLMWTNIVRQEWNEALFYANKLMAESKWSRSIYGYQKVCLMLMVKSDLSIADH-QEIDSIM 388
                     ******************.9**********************************************************999777777.9****** PP

         DUF3808 374 kevpkllqkkagkslplekFilrKverfkarkkekkselldavlvspvlEliYvwngfsrmskeeleeesvkkleeka.....ankese....ee 459
                     +++pk +q++agkslp+ekF+++K+er+ a++k          lv+p  El+ vwn f++++k+ +  +s+ + ++++     a    e    ++
  XP_022187702.1 389 SNIPKWRQRIAGKSLPMEKFCAKKSERYFAQNK---------NLVLPCFELLLVWNLFKVIGKKWEVCDSLYREIDESmrkldA----EaedpYD 470
                     ******************************977.........89*********************9999999888887666432....1234699 PP

         DUF3808 460 eDdellkkLLkglvlrr 476
                      D+++l+ LLkg++l +
  XP_022187702.1 471 ADNRALLLLLKGACLNQ 487
                     9*************987 PP

  == domain 2  score: -2.9 bits;  conditional E-value: 0.11
         DUF3808 280 slkgnldeAlelleei 295
                     + + nl++A++lle+ 
  XP_022187702.1 527 QQQNNLERAIQLLEDT 542
                     4444444444444432 PP



Or compare XP_022187702.1 to CDD or PaperBLAST