PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001320702.1 to PF10354 (BMT5-like)

NP_001320702.1 has 127 amino acids

Query:       BMT5-like  [M=168]
Accession:   PF10354.13
Description: rRNA (uridine-N3-)-methyltransferase BTM5-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.6e-37  113.5   0.0    7.6e-37  113.3   0.0    1.1  1  NP_001320702.1  


Domain annotation for each sequence (and alignments):
>> NP_001320702.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  113.3   0.0   7.6e-37   7.6e-37       1      96 [.      29     122 ..      29     127 .] 0.96

  Alignments for each domain:
  == domain 1  score: 113.3 bits;  conditional E-value: 7.6e-37
       BMT5-like   1 LlvGeGdfSFslslakalgsaeeealvatsldseeeleekypeaeenleeLeeegvkvlfgvDatklekeeklkkkkfdriiFnFPhvGgkskdv 95 
                     LlvGeGdfSFs+sla+ +gsa++  + a+slds++++ +ky++a++nle+L+++g+ +l+gvDat+l+ +++l+ ++fdr+iFnFPh+G++ k+ 
  NP_001320702.1  29 LLVGEGDFSFSCSLATCFGSASN--IYASSLDSYDDVVRKYKNARSNLETLKRLGAFLLHGVDATTLHFHPDLRYRRFDRVIFNFPHTGFHRKES 121
                     8********************99..******************************************************************9876 PP

       BMT5-like  96 e 96 
                     +
  NP_001320702.1 122 D 122
                     6 PP



Or compare NP_001320702.1 to CDD or PaperBLAST