PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1751099 to PF10615 (DUF2470)

VIMSS1751099 has 266 amino acids

Query:       DUF2470  [M=77]
Accession:   PF10615.12
Description: Domain of unknown function (DUF2470)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.6e-18   52.8   0.0    4.5e-18   52.1   0.0    1.4  1  VIMSS1751099  


Domain annotation for each sequence (and alignments):
>> VIMSS1751099  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   52.1   0.0   4.5e-18   4.5e-18       2      77 .]     185     259 ..     184     259 .. 0.93

  Alignments for each domain:
  == domain 1  score: 52.1 bits;  conditional E-value: 4.5e-18
                   HHHHHHHHHH-HHHHHHHHHHCST-TTCCEEEEEEE-SSEEEEEEC.....CEEEEEE-SS---SCCHHHHHHHHH CS
       DUF2470   2 ariiaHMNaDHaddlllylrhygkvkeakearmtdidldgltlrltakagsektvripFdpplkswaearerLveM 77 
                   a  iaH+NaDHad+ll+++r +g+ ++ +ea +t+ d++gl+lr+t+++g  +  r+ +  p++s++++r + ve+
  VIMSS1751099 185 AGAIAHLNADHADSLLAMARNLGGYPDTGEAVCTGADRYGLDLRVTTERG-VAYTRVGYAAPISSFDQLRAATVEL 259
                   678*****************************************965554.599******************9986 PP



Or compare VIMSS1751099 to CDD or PaperBLAST