NP_053814.1 has 108 amino acids
Query: Ycf54 [M=92]
Accession: PF10674.13
Description: Ycf54 protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-39 120.1 0.2 2.3e-39 119.9 0.2 1.0 1 NP_053814.1
Domain annotation for each sequence (and alignments):
>> NP_053814.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 119.9 0.2 2.3e-39 2.3e-39 1 91 [. 2 92 .. 2 93 .. 0.99
Alignments for each domain:
== domain 1 score: 119.9 bits; conditional E-value: 2.3e-39
Ycf54 1 ktYyfvvasakflleeepleevLkerarnykeknkeidfwlvkePaFleapelaeikaklpkpaaAivstdkqfitflklrLeyvlkgefe 91
+tYyf++as++fll+eepleev++er+ +y+ +nkeidfwl+++P+Fl++p + + k+ +p+ a Ai+st++ fi++lklr+ yv+ g+fe
NP_053814.1 2 TTYYFALASQNFLLSEEPLEEVFRERINYYQSNNKEIDFWLIPNPKFLNKPAMIKFKNLVPNEAIAIISTNSIFINWLKLRIGYVCIGQFE 92
59***************************************************************************************97 PP
Or compare NP_053814.1 to CDD or PaperBLAST