P72777 has 133 amino acids
Query: Ycf54 [M=92]
Accession: PF10674.13
Description: Ycf54 protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.7e-46 140.8 1.1 9.4e-46 140.4 1.1 1.2 1 P72777
Domain annotation for each sequence (and alignments):
>> P72777
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 140.4 1.1 9.4e-46 9.4e-46 2 92 .] 30 120 .. 29 120 .. 0.99
Alignments for each domain:
== domain 1 score: 140.4 bits; conditional E-value: 9.4e-46
Ycf54 2 tYyfvvasakflleeepleevLkerarnykeknkeidfwlvkePaFleapelaeikaklpkpaaAivstdkqfitflklrLeyvlkgefea 92
tYy+++as+kflleeep+eevLker+r+y eknkeidfw v +PaFl+apelae kak p+ +Aivst+k+fi ++klrLeyvl+gefea
P72777 30 TYYYALASQKFLLEEEPFEEVLKERRRDYGEKNKEIDFWQVIQPAFLNAPELAEAKAKAPEKNVAIVSTNKSFIVWVKLRLEYVLTGEFEA 120
8****************************************************************************************97 PP
Or compare P72777 to CDD or PaperBLAST