VIMSS5800266 has 79 amino acids
Query: DUF2492 [M=77] Accession: PF10678.13 Description: Protein of unknown function (DUF2492) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-40 122.5 0.4 3.8e-40 122.4 0.4 1.0 1 VIMSS5800266 Domain annotation for each sequence (and alignments): >> VIMSS5800266 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 122.4 0.4 3.8e-40 3.8e-40 2 77 .] 3 78 .. 2 78 .. 0.99 Alignments for each domain: == domain 1 score: 122.4 bits; conditional E-value: 3.8e-40 DUF2492 2 siHgHevlelllasgesltrasLkeaieekFGeearFhtCsaedltaeeLiefLlkkgKfiesedglttnaekiCn 77 siHgHevl+++++sge++t+ sL++ai+++FGe arFhtCsa+d+ta+eL++fL++kgKfi+ edg++t+++kiC+ VIMSS5800266 3 SIHGHEVLNMMIESGEQYTHTSLEAAIKARFGERARFHTCSASDMTAAELVAFLAAKGKFIAVEDGFSTHESKICR 78 8**************************************************************************6 PP
Or compare VIMSS5800266 to CDD or PaperBLAST