WP_011092763.1 has 56 amino acids
Query: DUF2496 [M=43]
Accession: PF10689.13
Description: Protein of unknown function (DUF2496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-29 88.1 2.3 1.6e-29 87.8 2.3 1.1 1 WP_011092763.1
Domain annotation for each sequence (and alignments):
>> WP_011092763.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 87.8 2.3 1.6e-29 1.6e-29 1 43 [] 2 44 .. 2 44 .. 0.99
Alignments for each domain:
== domain 1 score: 87.8 bits; conditional E-value: 1.6e-29
DUF2496 1 sLenApeevkLAVDLImLLEsnqiepevalaALeIVkrDfekK 43
sLenAp+evkLAVDLImLLE+nqiep++alaAL++V++DfekK
WP_011092763.1 2 SLENAPPEVKLAVDLIMLLEENQIEPRIALAALAMVQADFEKK 44
8*****************************************9 PP
Or compare WP_011092763.1 to CDD or PaperBLAST