WP_001071769.1 has 165 amino acids
Query: DUF2514 [M=161] Accession: PF10721.13 Description: Protein of unknown function (DUF2514) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-43 133.8 10.3 3.8e-43 133.5 10.3 1.0 1 WP_001071769.1 Domain annotation for each sequence (and alignments): >> WP_001071769.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 133.5 10.3 3.8e-43 3.8e-43 3 160 .. 3 159 .. 2 160 .. 0.95 Alignments for each domain: == domain 1 score: 133.5 bits; conditional E-value: 3.8e-43 DUF2514 3 qlavvvllaaalvvGfahGsakeeagweqkkadrdseqsqakvaaetaaRqeeqrrkaaaeearkdakeeaaaAradavgaaaegdrLrqeaakl 97 q+++v++l+ + Gf+ G++++++gw++k+a+rd++ +++v+a+ aaR +eq+r++a++ea+kda+++ a +a a+ + ++++Lr ea+k WP_001071769.1 3 QIFMVIFLV---LSGFIVGNVWSDRGWQKKWAERDAAALSQEVNAQFAARIIEQGRTIARDEAVKDAQQKSAEISARAAYLSDSVNQLRAEAKKY 94 567788888...46******************************************************************************996 PP DUF2514 98 ....aaarsavaadpaaadrgktaaraavvLadlLsrsaerarelAeaaDrariAgetCereYdavr 160 +aa++ +ad aaa+rgkt a +L+++L+ +a++a+ +Ae aD+ +iAg tC+++Y+++r WP_001071769.1 95 airlDAAKH--TADLAAAVRGKTTKTAEGMLTNMLGDIAAEAQLYAEIADERYIAGVTCQQIYESLR 159 66669****..******************************************************98 PP
Or compare WP_001071769.1 to CDD or PaperBLAST