P9WKX3 has 174 amino acids
Query: BPA [M=160] Accession: PF10759.13 Description: Bacterial proteasome activator Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-83 263.7 1.8 2.7e-83 263.4 1.8 1.0 1 P9WKX3 Domain annotation for each sequence (and alignments): >> P9WKX3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 263.4 1.8 2.7e-83 2.7e-83 6 144 .. 28 167 .. 24 174 .] 0.93 Alignments for each domain: == domain 1 score: 263.4 bits; conditional E-value: 2.7e-83 BPA 6 deeeeeeeevadlveqPakvmrigtmikqlleevraapldeasrkrlkeihersikeleeglaPelveelerlslpftedatPsdaelriaqaqlvGWleGlf 108 +e++++e++++dlveqPakvmrigtmikqlleevraapldeasr+rl++ih++si+ele+glaPel+eel+rl+lpf+eda+PsdaelriaqaqlvGWleGlf P9WKX3 28 QENDSDESSLTDLVEQPAKVMRIGTMIKQLLEEVRAAPLDEASRNRLRDIHATSIRELEDGLAPELREELDRLTLPFNEDAVPSDAELRIAQAQLVGWLEGLF 130 67888999*********************************************************************************************** PP BPA 109 hGiqtalvaqqmaaraqleqlrr.alPpggeaaeeeg 144 hGiqtal+aqqmaaraql+q+r+ alPpg ++ ++g P9WKX3 131 HGIQTALFAQQMAARAQLQQMRQgALPPGVGKSGQHG 167 ***********************99****55544444 PP
Or compare P9WKX3 to CDD or PaperBLAST