VIMSS1750945 has 175 amino acids
Query: BPA [M=160] Accession: PF10759.13 Description: Bacterial proteasome activator Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-85 269.5 1.2 4.5e-85 269.2 1.2 1.0 1 VIMSS1750945 Domain annotation for each sequence (and alignments): >> VIMSS1750945 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 269.2 1.2 4.5e-85 4.5e-85 5 160 .] 23 175 .] 19 175 .] 0.91 Alignments for each domain: == domain 1 score: 269.2 bits; conditional E-value: 4.5e-85 BPA 5 edeeeeeeeevadlveqPakvmrigtmikqlleevraapldeasrkrlkeihersikeleeglaPelveelerlslpftedatPsdaelriaqaqlv 101 e e e e ++++dlveqPakvmrigtmikqlleevraapld+asr+rl+eih++si+ele+glaPel+eelerl+lpft+d++Psdaelriaqaqlv VIMSS1750945 23 EGEGEGEGKSLTDLVEQPAKVMRIGTMIKQLLEEVRAAPLDDASRNRLREIHQTSIRELEDGLAPELREELERLTLPFTDDNVPSDAELRIAQAQLV 119 567788999**************************************************************************************** PP BPA 102 GWleGlfhGiqtalvaqqmaaraqleqlrr.alPpggeaaeeegeeeeegeekestgqyl 160 GWleGlfhGiqtal+aqqmaaraqleq+r+ alPpg ++ g ++ g+++ +tgqyl VIMSS1750945 120 GWLEGLFHGIQTALFAQQMAARAQLEQMRQgALPPGIQV---PG-AQRGGATHPGTGQYL 175 ******************************99****333...33.333556677888886 PP
Or compare VIMSS1750945 to CDD or PaperBLAST