VIMSS2227985 has 169 amino acids
Query: BPA [M=160] Accession: PF10759.13 Description: Bacterial proteasome activator Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-82 260.6 1.7 2.3e-82 260.4 1.7 1.0 1 VIMSS2227985 Domain annotation for each sequence (and alignments): >> VIMSS2227985 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 260.4 1.7 2.3e-82 2.3e-82 5 137 .. 23 157 .. 19 168 .. 0.94 Alignments for each domain: == domain 1 score: 260.4 bits; conditional E-value: 2.3e-82 BPA 5 edeeeeeeeevadlveqPakvmrigtmikqlleevraapldeasrkrlkeihersikeleeglaPelveelerlslpftedatPsdaelriaqaqlv 101 d+++++e++++dlveqPakvmrigtmikqlleevraapld+asr+rl+eih++si+eleeglaPel+eel+rl+lpf+eda+Psdaelriaqaqlv VIMSS2227985 23 VDDDDADERSLTDLVEQPAKVMRIGTMIKQLLEEVRAAPLDDASRNRLREIHATSIRELEEGLAPELREELDRLTLPFNEDAAPSDAELRIAQAQLV 119 6788999****************************************************************************************** PP BPA 102 GWleGlfhGiqtalvaqqmaaraqleqlrr.alPpg.g 137 GWleGlfhGiqtal+aqqmaaraqle++r+ alP+g g VIMSS2227985 120 GWLEGLFHGIQTALFAQQMAARAQLEKMRQgALPSGiG 157 ******************************99***942 PP
Or compare VIMSS2227985 to CDD or PaperBLAST