VIMSS35554 has 178 amino acids
Query: BPA [M=160] Accession: PF10759.13 Description: Bacterial proteasome activator Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-83 263.6 1.8 3e-83 263.3 1.8 1.0 1 VIMSS35554 Domain annotation for each sequence (and alignments): >> VIMSS35554 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 263.3 1.8 3e-83 3e-83 6 144 .. 32 171 .. 28 178 .] 0.93 Alignments for each domain: == domain 1 score: 263.3 bits; conditional E-value: 3e-83 BPA 6 deeeeeeeevadlveqPakvmrigtmikqlleevraapldeasrkrlkeihersikeleeglaPelveelerlslpftedatPsdaelriaqaqlvGWl 104 +e++++e++++dlveqPakvmrigtmikqlleevraapldeasr+rl++ih++si+ele+glaPel+eel+rl+lpf+eda+PsdaelriaqaqlvGWl VIMSS35554 32 QENDSDESSLTDLVEQPAKVMRIGTMIKQLLEEVRAAPLDEASRNRLRDIHATSIRELEDGLAPELREELDRLTLPFNEDAVPSDAELRIAQAQLVGWL 130 67888999******************************************************************************************* PP BPA 105 eGlfhGiqtalvaqqmaaraqleqlrr.alPpggeaaeeeg 144 eGlfhGiqtal+aqqmaaraql+q+r+ alPpg ++ ++g VIMSS35554 131 EGLFHGIQTALFAQQMAARAQLQQMRQgALPPGVGKSGQHG 171 ***************************99****55544444 PP
Or compare VIMSS35554 to CDD or PaperBLAST