VIMSS606574 has 89 amino acids
Query: DUF2583 [M=88]
Accession: PF10762.13
Description: Protein of unknown function (DUF2583)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.6e-50 154.4 0.9 5.1e-50 154.2 0.9 1.0 1 VIMSS606574
Domain annotation for each sequence (and alignments):
>> VIMSS606574
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 154.2 0.9 5.1e-50 5.1e-50 1 88 [] 1 88 [. 1 88 [. 0.99
Alignments for each domain:
== domain 1 score: 154.2 bits; conditional E-value: 5.1e-50
DUF2583 1 mkrkkalllGnvlmglGlllmvaslaysilnqlfelnlpellaeaallgifvGallWlaGarvgGreevadrywWlrhfdkryrrkkh 88
mkrk+++ lGnvlmglG++lm++++++si++q+++ln+pe++++++l+gif+Ga++Wl+Gar++GreevadrywW++hfdkr+rr++h
VIMSS606574 1 MKRKNVAALGNVLMGLGMILMIGGIGFSIASQFPKLNVPEYMTYIDLVGIFSGAIFWLVGARISGREEVADRYWWVKHFDKRCRRQRH 88
9*************************************************************************************97 PP
Or compare VIMSS606574 to CDD or PaperBLAST