WP_004242663.1 has 92 amino acids
Query: DUF2583 [M=88]
Accession: PF10762.13
Description: Protein of unknown function (DUF2583)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.5e-44 134.5 0.8 8.7e-44 134.3 0.8 1.0 1 WP_004242663.1
Domain annotation for each sequence (and alignments):
>> WP_004242663.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 134.3 0.8 8.7e-44 8.7e-44 1 87 [. 1 87 [. 1 88 [. 0.99
Alignments for each domain:
== domain 1 score: 134.3 bits; conditional E-value: 8.7e-44
DUF2583 1 mkrkkalllGnvlmglGlllmvaslaysilnqlfelnlpellaeaallgifvGallWlaGarvgGreevadrywWlrhfdkryrrkk 87
mk k+a+ +Gn+lm++G++lm++sl+y +l+++f l+lp++l++a+l+gif+Gal+WlaGar+gGre va+rywWlr++d+ryrr++
WP_004242663.1 1 MKYKHAFAVGNLLMAIGMVLMLGSLGYNLLSHIFPLGLPDILSDASLMGIFIGALVWLAGARIGGRETVAERYWWLRNHDERYRRHD 87
99***********************************************************************************87 PP
Or compare WP_004242663.1 to CDD or PaperBLAST