WP_029368994.1 has 89 amino acids
Query: DUF2583 [M=88] Accession: PF10762.13 Description: Protein of unknown function (DUF2583) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-50 154.9 0.9 3.4e-50 154.8 0.9 1.0 1 WP_029368994.1 Domain annotation for each sequence (and alignments): >> WP_029368994.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 154.8 0.9 3.4e-50 3.4e-50 1 88 [] 1 88 [. 1 88 [. 0.99 Alignments for each domain: == domain 1 score: 154.8 bits; conditional E-value: 3.4e-50 DUF2583 1 mkrkkalllGnvlmglGlllmvaslaysilnqlfelnlpellaeaallgifvGallWlaGarvgGreevadrywWlrhfdkryrrkkh 88 mkrk++++lGnvlmg+G+++m++++++si++q+++ln+pe++++++l++if+Ga++WlaGar++GreevadrywW++hfdkr+rr++h WP_029368994.1 1 MKRKNVTVLGNVLMGIGMIMMIGGIGFSIASQFPKLNVPEYMTYIDLVSIFSGAIFWLAGARISGREEVADRYWWVKHFDKRCRRQRH 88 9*************************************************************************************97 PP
Or compare WP_029368994.1 to CDD or PaperBLAST