VIMSS3411179 has 56 amino acids
Query: YhfG [M=54]
Accession: PF10832.12
Description: YhfG
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-29 87.6 0.5 2.2e-29 87.5 0.5 1.0 1 VIMSS3411179
Domain annotation for each sequence (and alignments):
>> VIMSS3411179
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 87.5 0.5 2.2e-29 2.2e-29 1 54 [] 3 56 .] 3 56 .] 0.99
Alignments for each domain:
== domain 1 score: 87.5 bits; conditional E-value: 2.2e-29
YhfG 1 tkltlkqKkryfaktRnaNyqASlRLEGldiplvtlsaeeaaqrleallrhYer 54
+klt+kqK+r++++++n+N+qAS RLEG+++plvtls eea++r+e+l++hYer
VIMSS3411179 3 KKLTDKQKSRLWDAQKNQNFQASNRLEGIEVPLVTLSREEALARIEELRGHYER 56
79***************************************************8 PP
Or compare VIMSS3411179 to CDD or PaperBLAST