VIMSS95682 has 55 amino acids
Query: YhfG [M=54]
Accession: PF10832.12
Description: YhfG
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.1e-29 86.3 1.8 5.6e-29 86.2 1.8 1.0 1 VIMSS95682
Domain annotation for each sequence (and alignments):
>> VIMSS95682
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 86.2 1.8 5.6e-29 5.6e-29 1 54 [] 2 55 .] 2 55 .] 0.99
Alignments for each domain:
== domain 1 score: 86.2 bits; conditional E-value: 5.6e-29
YhfG 1 tkltlkqKkryfaktRnaNyqASlRLEGldiplvtlsaeeaaqrleallrhYer 54
+klt+kqK+r+++ +Rn+N+qAS+RLEG+++plvtl+a ea++rle+l+ hYer
VIMSS95682 2 KKLTDKQKSRLWELQRNRNFQASRRLEGVEMPLVTLTAAEALARLEELRSHYER 55
79***************************************************8 PP
Or compare VIMSS95682 to CDD or PaperBLAST