PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS149478 to PF10836 (DUF2574)

VIMSS149478 has 93 amino acids

Query:       DUF2574  [M=93]
Accession:   PF10836.12
Description: Protein of unknown function (DUF2574)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-57  177.5   2.5      2e-57  177.4   2.5    1.0  1  VIMSS149478  


Domain annotation for each sequence (and alignments):
>> VIMSS149478  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  177.4   2.5     2e-57     2e-57       1      93 []       1      93 []       1      93 [] 1.00

  Alignments for each domain:
  == domain 1  score: 177.4 bits;  conditional E-value: 2e-57
      DUF2574  1 mkkyllmGiivlayGlsspvfasdtatltisGkvtaptcsaevvnaqlqqrcGnltyvadarelasspvrGvttevvtvpgdskrqivlnryd 93
                 mkkyllmGiiv+ayG+s+pvfasdtatltisGkvtaptcs+evvnaqlqqrcGn+++v++++++a++p+rGvtt+++tvpgds+rqiv+n+yd
  VIMSS149478  1 MKKYLLMGIIVSAYGISVPVFASDTATLTISGKVTAPTCSTEVVNAQLQQRCGNTIHVSTLQTPAATPMRGVTTQLYTVPGDSTRQIVVNHYD 93
                 9*******************************************************************************************9 PP



Or compare VIMSS149478 to CDD or PaperBLAST