B2RVB9 has 118 amino acids
Query: DUF2678 [M=118] Accession: PF10856.12 Description: Protein of unknown function (DUF2678) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-73 229.1 1.6 4.5e-73 229.0 1.6 1.0 1 B2RVB9 Domain annotation for each sequence (and alignments): >> B2RVB9 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 229.0 1.6 4.5e-73 4.5e-73 1 118 [] 1 118 [] 1 118 [] 1.00 Alignments for each domain: == domain 1 score: 229.0 bits; conditional E-value: 4.5e-73 DUF2678 1 mddfatrtygtsgldnrplfgetsardriinlavggltsllvlvtvissfvfpslppkalniffavcillicssvlvlifwyrqgdlepkfrnliyyilasi 102 m+dfatrtygtsgldnrplfgetsa+driinl+vg+lt+ll+lvt+is+fvfp+lppk+lniffavci+l+++++++li+wyrqgdlepkfrnliyyil+si B2RVB9 1 MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTTLLILVTLISAFVFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFRNLIYYILFSI 102 9***************************************************************************************************** PP DUF2678 103 illclcanlyfhdvgr 118 i+lc+canlyfhdvgr B2RVB9 103 IMLCICANLYFHDVGR 118 **************98 PP
Or compare B2RVB9 to CDD or PaperBLAST