SwissProt::Q9BU79 has 118 amino acids
Query: DUF2678 [M=118] Accession: PF10856.12 Description: Protein of unknown function (DUF2678) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-73 230.6 1.4 1.6e-73 230.4 1.4 1.0 1 SwissProt::Q9BU79 Domain annotation for each sequence (and alignments): >> SwissProt::Q9BU79 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 230.4 1.4 1.6e-73 1.6e-73 1 118 [] 1 118 [] 1 118 [] 1.00 Alignments for each domain: == domain 1 score: 230.4 bits; conditional E-value: 1.6e-73 DUF2678 1 mddfatrtygtsgldnrplfgetsardriinlavggltsllvlvtvissfvfpslppkalniffavcillicssvlvlifwyrqgdlepkfr 92 m+dfatrtygtsgldnrplfgetsa+driinl+vg+ltsll+lvt+is+fvfp+lppk+lniffavci+l+++++++li+wyrqgdlepkfr SwissProt::Q9BU79 1 MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFR 92 9******************************************************************************************* PP DUF2678 93 nliyyilasiillclcanlyfhdvgr 118 +liyyi++sii+lc+canlyfhdvgr SwissProt::Q9BU79 93 KLIYYIIFSIIMLCICANLYFHDVGR 118 ************************98 PP
Or compare SwissProt::Q9BU79 to CDD or PaperBLAST