P44232 has 63 amino acids
Query: DUF2635 [M=46] Accession: PF10948.12 Description: Protein of unknown function (DUF2635) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-24 72.0 0.0 1.5e-24 71.8 0.0 1.1 1 P44232 Domain annotation for each sequence (and alignments): >> P44232 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.8 0.0 1.5e-24 1.5e-24 1 46 [] 6 51 .. 6 51 .. 0.98 Alignments for each domain: == domain 1 score: 71.8 bits; conditional E-value: 1.5e-24 DUF2635 1 vkPaeGlkVRdPetgqlLpaeGeevprtsyWlRRlkdGDVvlvkek 46 +kP++Gl +RdPet++lL+++Ge++p+ syWl++lk+GDV+lv+e+ P44232 6 IKPKTGLLIRDPETFELLSESGEDKPKISYWLNHLKNGDVELVTET 51 8******************************************985 PP
Or compare P44232 to CDD or PaperBLAST