VIMSS887014 has 62 amino acids
Query: DUF2635 [M=46]
Accession: PF10948.12
Description: Protein of unknown function (DUF2635)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-23 68.9 0.5 1.3e-23 68.7 0.5 1.1 1 VIMSS887014
Domain annotation for each sequence (and alignments):
>> VIMSS887014
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 68.7 0.5 1.3e-23 1.3e-23 2 46 .] 8 52 .. 7 52 .. 0.95
Alignments for each domain:
== domain 1 score: 68.7 bits; conditional E-value: 1.3e-23
DUF2635 2 kPaeGlkVRdPetgqlLpaeGeevprtsyWlRRlkdGDVvlvkek 46
PaeG++V+dPe g+lLp eG++v+ +++W+RR++dGD++l +e+
VIMSS887014 8 IPAEGRTVPDPEAGDLLPVEGRQVTFNAWWQRRQNDGDITLKTEQ 52
6***************************************99875 PP
Or compare VIMSS887014 to CDD or PaperBLAST