WP_000497739.1 has 54 amino acids
Query: DUF2635 [M=46]
Accession: PF10948.12
Description: Protein of unknown function (DUF2635)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.9e-21 60.1 1.5 7.9e-21 59.9 1.5 1.1 1 WP_000497739.1
Domain annotation for each sequence (and alignments):
>> WP_000497739.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.9 1.5 7.9e-21 7.9e-21 1 44 [. 3 46 .. 3 48 .. 0.95
Alignments for each domain:
== domain 1 score: 59.9 bits; conditional E-value: 7.9e-21
DUF2635 1 vkPaeGlkVRdPetgqlLpaeGeevprtsyWlRRlkdGDVvlvk 44
vkPa+G+ V+dP g+lLp+ G++v+ + yWlRR + GDV ++
WP_000497739.1 3 VKPAKGRSVPDPARGDLLPEGGRNVDENNYWLRREAAGDVRRTN 46
9***************************************7766 PP
Or compare WP_000497739.1 to CDD or PaperBLAST