YP_003335786.1 has 68 amino acids
Query: DUF2635 [M=46]
Accession: PF10948.12
Description: Protein of unknown function (DUF2635)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.2e-26 75.8 0.0 9.8e-26 75.6 0.0 1.1 1 YP_003335786.1
Domain annotation for each sequence (and alignments):
>> YP_003335786.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 75.6 0.0 9.8e-26 9.8e-26 1 44 [. 5 48 .. 5 50 .. 0.97
Alignments for each domain:
== domain 1 score: 75.6 bits; conditional E-value: 9.8e-26
DUF2635 1 vkPaeGlkVRdPetgqlLpaeGeevprtsyWlRRlkdGDVvlvk 44
+kPa+G+++RdP t++lL++eGee+p +s+W+RRl+ GDVv+v
YP_003335786.1 5 IKPAAGKAIRDPLTMKLLAPEGEEKPHNSFWIRRLAAGDVVEVG 48
8*****************************************96 PP
Or compare YP_003335786.1 to CDD or PaperBLAST