VIMSS899376 has 37 amino acids
Query: DUF2770 [M=36]
Accession: PF10968.12
Description: Protein of unknown function (DUF2770)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-28 83.8 14.4 3.6e-28 83.6 14.4 1.0 1 VIMSS899376
Domain annotation for each sequence (and alignments):
>> VIMSS899376
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 83.6 14.4 3.6e-28 3.6e-28 1 36 [] 1 36 [. 1 36 [. 0.99
Alignments for each domain:
== domain 1 score: 83.6 bits; conditional E-value: 3.6e-28
DUF2770 1 mRRlfhyLiNNiREHfMlYliLWsLLAimDlvyllf 36
mRRlfh+L+NNiREHfMlY+iLWsLLA+mD+vyllf
VIMSS899376 1 MRRLFHFLMNNIREHFMLYVILWSLLAVMDIVYLLF 36
9**********************************9 PP
Or compare VIMSS899376 to CDD or PaperBLAST