PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001084560.1 to PF11027 (DUF2615)

NP_001084560.1 has 103 amino acids

Query:       DUF2615  [M=104]
Accession:   PF11027.12
Description: Protein of unknown function (DUF2615)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.5e-45  138.0   0.0    6.3e-45  137.8   0.0    1.0  1  NP_001084560.1  


Domain annotation for each sequence (and alignments):
>> NP_001084560.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  137.8   0.0   6.3e-45   6.3e-45       2     103 ..       3     101 ..       2     102 .. 0.97

  Alignments for each domain:
  == domain 1  score: 137.8 bits;  conditional E-value: 6.3e-45
         DUF2615   2 edefDpCeciwshelamrRLlsllrqsQsaCtDneCldelpgpeaseegdnslfliallwlvlalvlyllrPsslrnlssknkpsrkdnnsddds 96 
                     e+ fDpCeci+she+a+rRL++llrqsQs+CtD+eCl+elpgp++s++g+ s+++ia++wlv+ + lyllrP+slr +++++kp++++nn+    
  NP_001084560.1   3 EGSFDPCECICSHEHAIRRLINLLRQSQSYCTDTECLQELPGPNSSSDGGISIAMIAMAWLVIGFTLYLLRPRSLRGTRTSSKPTSPHNNHG--- 94 
                     689****************************************************************************************9... PP

         DUF2615  97 peppppp 103
                     pepp+pp
  NP_001084560.1  95 PEPPAPP 101
                     8888887 PP



Or compare NP_001084560.1 to CDD or PaperBLAST