VIMSS149822 has 63 amino acids
Query: DUF2633 [M=43] Accession: PF11119.12 Description: Protein of unknown function (DUF2633) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-34 101.4 3.5 1.2e-33 101.1 3.5 1.1 1 VIMSS149822 Domain annotation for each sequence (and alignments): >> VIMSS149822 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.1 3.5 1.2e-33 1.2e-33 1 43 [] 7 49 .. 7 49 .. 0.98 Alignments for each domain: == domain 1 score: 101.1 bits; conditional E-value: 1.2e-33 DUF2633 1 mrrrrrknsrmtRiVLLISFiiLlGRlvYssiGAwehHqdKkq 43 mr+r+r+n+rmtRiVLLISF++++GR+vYssiGAw+hHqdKk+ VIMSS149822 7 MRKRHRFNTRMTRIVLLISFLFFFGRFVYSSIGAWQHHQDKKE 49 89***************************************97 PP
Or compare VIMSS149822 to CDD or PaperBLAST