VIMSS1119980 has 141 amino acids
Query: DUF2946 [M=118] Accession: PF11162.12 Description: Protein of unknown function (DUF2946) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-11 30.1 14.2 4.5e-11 29.7 14.2 1.2 1 VIMSS1119980 Domain annotation for each sequence (and alignments): >> VIMSS1119980 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.7 14.2 4.5e-11 4.5e-11 3 118 .] 14 139 .. 12 139 .. 0.70 Alignments for each domain: == domain 1 score: 29.7 bits; conditional E-value: 4.5e-11 DUF2946 3 lallavll.............avlaPlvsqaaaaaaaasllageiCssagsaaaaaaaagdagddsaasaadsehCgyCsllaagpalppaalapll 86 lalla++ a+ aP++++ +a++aa ++ + +++++ +a+a a ++ ++ + +ds+hC++C++la + ++ +++++l+ VIMSS1119980 14 LALLALAIqfvlsfghhhgavALAAPAIAM-QASDAAGTGTDKTLATHDSD--PANASAPRPAEPTSGADQDSDHCAVCAVLALARTVLFSVPPVLP 107 556655555566666666654569999999.88888888888899999988..777777777777777788888********986666666555555 PP DUF2946 87 paaaaaaapalalaaapalpallpaarpRAPP 118 + a + ++ a a + +l+ ++ a +pRAPP VIMSS1119980 108 LQDAYHVLYLTAAAEFNHLESRRVAFQPRAPP 139 5555555555555555566666666667***9 PP
Or compare VIMSS1119980 to CDD or PaperBLAST