WP_002914119.1 has 152 amino acids
Query: DUF2946 [M=118] Accession: PF11162.12 Description: Protein of unknown function (DUF2946) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-25 76.0 17.7 3.9e-25 75.1 17.7 1.4 1 WP_002914119.1 Domain annotation for each sequence (and alignments): >> WP_002914119.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.1 17.7 3.9e-25 3.9e-25 1 118 [] 16 145 .. 16 145 .. 0.88 Alignments for each domain: == domain 1 score: 75.1 bits; conditional E-value: 3.9e-25 DUF2946 1 awlallavllavlaPlvsqaaaaaaaasllageiCssags..............aaaaaaaagdagddsaasaadse.hCgyCsllaagpalppa 80 awlalla+ll+v+aPl+s + ++++++a++ +++a++ ++a+++ ++a+++++ ++ d++ +CgyC+lla++p+l a WP_002914119.1 16 AWLALLAILLIVVAPLISV---SLQKDPMSAMPGMHHAMMmdsssasmaqmpghKMAMMHSTDGATHTGHEMPLDHAeACGYCVLLAHVPGLLFA 107 8******************...9999999999999999889999999*******555555555555555555555555***************** PP DUF2946 81 alapllpaaaaaaapalalaaapalpallpaarpRAPP 118 ++++++++++ ++ p+++ + + + + + +++RAPP WP_002914119.1 108 LALFVAMLLRRIRLPVSRPVLKHWHYFPWLYPETRAPP 145 *************************************9 PP
Or compare WP_002914119.1 to CDD or PaperBLAST