PaperBLAST – Find papers about a protein or its homologs

 

Align O85477 to PF11187 (Mbeg1-like)

O85477 has 324 amino acids

Query:       Mbeg1-like  [M=224]
Accession:   PF11187.12
Description: Mbeg1-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.2e-08   19.5   0.4    5.1e-08   18.8   0.4    1.2  1  O85477    


Domain annotation for each sequence (and alignments):
>> O85477  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   18.8   0.4   5.1e-08   5.1e-08      27     104 ..     137     212 ..     127     218 .. 0.87

  Alignments for each domain:
  == domain 1  score: 18.8 bits;  conditional E-value: 5.1e-08
  Mbeg1-like  27 FaAvtfrlskdtlvvafRGtddtligWkedfnlsfrsevkaqksAakYlkkilektegkiylaGhSkGgnlAvyaaan 104
                 F+A  ++ +++++v +f Gt+d +  W  +++ +  +e    ++A+   k++++++ ++++++GhS Gg lA+ aa++
      O85477 137 FQAGIYS-DNQQYVLSFAGTND-IQDWLSNIRQATGYEDVQYNQAVALGKTAKMAFGDALVITGHSLGGGLAATAALA 212
                 6666665.788999******98.89*******99888888889999999999999*******************9975 PP



Or compare O85477 to CDD or PaperBLAST