PaperBLAST – Find papers about a protein or its homologs

 

Align P18952 to PF11187 (Mbeg1-like)

P18952 has 319 amino acids

Query:       Mbeg1-like  [M=224]
Accession:   PF11187.12
Description: Mbeg1-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.3e-07   16.7   1.2    3.5e-07   16.1   1.2    1.2  1  P18952    


Domain annotation for each sequence (and alignments):
>> P18952  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   16.1   1.2   3.5e-07   3.5e-07      27     104 ..     131     206 ..     122     212 .. 0.82

  Alignments for each domain:
  == domain 1  score: 16.1 bits;  conditional E-value: 3.5e-07
  Mbeg1-like  27 FaAvtfrlskdtlvvafRGtddtligWkedfnlsfrsevkaqksAakYlkkilektegkiylaGhSkGgnlAvyaaan 104
                 F+A  ++ +++++v af Gt+d    W  +++ +  +     ++A+   k++++++ +++++aGhS Gg lA+ aa++
      P18952 131 FQAGIYS-NDKQYVLAFAGTNDW-RDWLSNVRQATGYDDVQYNQAVAAAKSAKAAFGDALVIAGHSLGGGLAATAALA 206
                 5565555.46788999****985.689999988877776777788888899999********************9986 PP



Or compare P18952 to CDD or PaperBLAST