VIMSS146058 has 320 amino acids
Query: Mbeg1-like [M=224]
Accession: PF11187.12
Description: Mbeg1-like
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7e-08 18.3 0.4 1.2e-07 17.5 0.4 1.3 1 VIMSS146058
Domain annotation for each sequence (and alignments):
>> VIMSS146058
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 17.5 0.4 1.2e-07 1.2e-07 31 104 .. 137 208 .. 125 215 .. 0.88
Alignments for each domain:
== domain 1 score: 17.5 bits; conditional E-value: 1.2e-07
Mbeg1-like 31 tfrlskdtlvvafRGtddtligWkedfnlsfrsevkaqksAakYlkkilektegkiylaGhSkGgnlAvyaaan 104
++ +++++v +f Gt+d W +++ ++ +e ++A+ k++++++ ++++++GhS Gg lA+ aa++
VIMSS146058 137 IYS-DNQQYVLSFAGTNDRH-DWLSNIRQAVGYEDVQYNEAVALGKTAKMAFGDALVITGHSLGGGLAATAALA 208
444.6889999******985.9********9999999999**999*************************9986 PP
Or compare VIMSS146058 to CDD or PaperBLAST