PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS258740 to PF11187 (Mbeg1-like)

VIMSS258740 has 395 amino acids

Query:       Mbeg1-like  [M=224]
Accession:   PF11187.12
Description: Mbeg1-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.9e-10   24.7   0.1    1.9e-09   23.5   0.1    1.5  1  VIMSS258740  


Domain annotation for each sequence (and alignments):
>> VIMSS258740  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.5   0.1   1.9e-09   1.9e-09      21     104 ..      77     159 ..      69     169 .. 0.91

  Alignments for each domain:
  == domain 1  score: 23.5 bits;  conditional E-value: 1.9e-09
   Mbeg1-like  21 eeeqkqFaAvtfrlskdtlvvafRGtddtligWkedfnlsfrsevkaqksAakYlkkilektegkiylaGhSkGgnlAvyaaan 104
                  +++++ F A+ +r ++++ v  f Gtd+    Wk ++        +   sA++  +++++++ ++++++GhS Gg lA+ +a+ 
  VIMSS258740  77 HDAKSGFDAAFYRNDQGQVVLGFCGTDEGK-DWKHNIGQGLGLDDAQYASAIQLGSQAKQAFGDQVVISGHSLGGGLAAASAMV 159
                  566788*********************985.9*****99988887888899****************************99996 PP



Or compare VIMSS258740 to CDD or PaperBLAST