XP_003079966.2 has 515 amino acids
Query: Mbeg1-like [M=224]
Accession: PF11187.12
Description: Mbeg1-like
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.1e-08 19.5 0.0 5.2e-08 18.8 0.0 1.4 1 XP_003079966.2
Domain annotation for each sequence (and alignments):
>> XP_003079966.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 18.8 0.0 5.2e-08 5.2e-08 85 129 .. 219 263 .. 140 288 .. 0.82
Alignments for each domain:
== domain 1 score: 18.8 bits; conditional E-value: 5.2e-08
Mbeg1-like 85 kiylaGhSkGgnlAvyaaanaeddlqerikkiysfDgPGlekevl 129
+i l+GhS Gg Av a+ ++++ ++r+k++++f +P l + +
XP_003079966.2 219 EIQLTGHSLGGAAAVALALLIHKKGKARVKRVVTFGAPKLGPKET 263
599***********************************8865544 PP
Or compare XP_003079966.2 to CDD or PaperBLAST